DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and sec22a

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_955992.1 Gene:sec22a / 324832 ZFINID:ZDB-GENE-030131-3553 Length:303 Species:Danio rerio


Alignment Length:171 Identity:31/171 - (18%)
Similarity:71/171 - (41%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGL-QVATAIAYSMNTEFSKILA 111
            |.|.|::|....:.|:.:....:....||.||.:::::||.||.. ::.:|:......||...:.
Zfish    56 GLYNINFTSSLGVGYLMVCTENYPNVLAFSFLDELQREFIVTYDTKRINSALRPFSFVEFDNFIR 120

  Fly   112 QQMVYFSQSREVDTISRVHGQIDELK-----DIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAF 171
            :..:.::..|.:.|...:.....|:|     .:..::|.|:....:..|   :|.:.::.|.   
Zfish   121 KTKLRYNSPRSLSTKINLADMRTEIKLRPPYQLSAEDIGSINGFSQHKE---SKYKGIAPNQ--- 179

  Fly   172 RKASRNLARQMFWKNIRVYVVVGLVITFIVYVIVSMACGGL 212
                               ::..:.::.||..::|:.||.|
Zfish   180 -------------------MLEAVTLSGIVACVLSILCGAL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 13/49 (27%)
Synaptobrevin 122..210 CDD:279324 11/92 (12%)
R-SNARE_VAMP7 124..188 CDD:277224 8/68 (12%)
sec22aNP_955992.1 SNC1 8..>146 CDD:227472 19/89 (21%)
Longin 38..106 CDD:290490 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.