DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Sec22a

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_006522298.1 Gene:Sec22a / 317717 MGIID:2447876 Length:323 Species:Mus musculus


Alignment Length:222 Identity:38/222 - (17%)
Similarity:76/222 - (34%) Gaps:61/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KMTYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYG-LQVATAIAYSMNTE 105
            :.|...|.|.|::.....:.||.:....:....||.||.:::::||.||. ::..||:......|
Mouse    66 RCTLKTGRYNINFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIE 130

  Fly   106 FSKILAQQMVYFSQSREVDTISRVHGQIDELK----------------------DIMVKNIDSLR 148
            |...:.:....::..|.:.|...:.....|:|                      .:..|....:.
Mouse   131 FDNFIQRTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKIS 195

  Fly   149 DRGEKLE------------------------------LLVNKTENLSNNSVAFRKASRNLARQMF 183
            ...::||                              ||.:..|:| |..:||...:.....|.:
Mouse   196 SAHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDL-NYIIAFFLGTAACLYQCY 259

  Fly   184 -------WKNIRVYVVVGLVITFIVYV 203
                   |:|::.::..||:....:|:
Mouse   260 LLVYYTSWRNVKSFLTFGLICLCNMYL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 14/55 (25%)
Synaptobrevin 122..210 CDD:279324 19/141 (13%)
R-SNARE_VAMP7 124..188 CDD:277224 16/122 (13%)
Sec22aXP_006522298.1 Longin 21..142 CDD:341428 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.