DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Ykt6

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:63/131 - (48%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YLIH-YTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQVATAIAYSMNTEFS---KIL 110
            |:.| |...:.|..:.|.|:|:....|...:..|...|...     .:|..:...||.:   .:|
  Fly    65 YMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAK-----VSADQWPNGTEATISFDLL 124

  Fly   111 AQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKAS 175
            ...:..:....|.|.::::...:||.|.|:...|:::.:|||||:.:|:|:|.||..|.||.|.:
  Fly   125 PAFLARYQNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTA 189

  Fly   176 R 176
            :
  Fly   190 K 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 10/47 (21%)
Synaptobrevin 122..210 CDD:279324 21/55 (38%)
R-SNARE_VAMP7 124..188 CDD:277224 20/53 (38%)
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448294
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.