DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Sec22

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster


Alignment Length:201 Identity:52/201 - (25%)
Similarity:100/201 - (49%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHN-HKMTYTHGDYLIHYTCENKLVYMCITDNEFE 71
            :..|.::|        ::....:.:..::|.|: .:.:...|.||.||..||.:.|:.:.|..:.
  Fly    26 VPSGRSIL--------DYQNQAKMLFRKLGTHSPARCSIETGPYLFHYLIENDVCYLVMVDKMYS 82

  Fly    72 RSRAFLFLADIKQKFIQTYGLQVATAIAYSMNTEFSKILAQQMVYFSQSREVDT-----ISRVHG 131
            :..||.:|.|:.|:|...||.:|.:........||.       ||..::::..|     ||.::.
  Fly    83 KRLAFNYLEDLAQEFHANYGRRVNSVTRPYAFIEFD-------VYIQKAKKQLTDRRRNISNINT 140

  Fly   132 QIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVVGLV 196
            |:.:::.|||:|||.:..||..|..|..||:|||..|..::|.::.|.|:..:  ::...:..::
  Fly   141 QLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKSMY--VKAMALGMIL 203

  Fly   197 ITFIVY 202
            :.||:|
  Fly   204 LVFIMY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 20/65 (31%)
Synaptobrevin 122..210 CDD:279324 26/86 (30%)
R-SNARE_VAMP7 124..188 CDD:277224 23/68 (34%)
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 49/180 (27%)
Longin 39..105 CDD:290490 19/65 (29%)
R-SNARE_SEC22 132..195 CDD:277219 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448301
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.