DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Vamp1

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_037222.2 Gene:Vamp1 / 25624 RGDID:3948 Length:118 Species:Rattus norvegicus


Alignment Length:80 Identity:24/80 - (30%)
Similarity:47/80 - (58%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :.:...|::|:.|||..|:|.:.:|.:||..|.::.:.|...:..|..::..|.|:.:|||.::.
  Rat    34 LQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMM 98

  Fly   191 VVVGLVITFIVYVIV 205
            :::|.:...||.|||
  Rat    99 IMLGAICAIIVVVIV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 18/61 (30%)
Vamp1NP_037222.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 0/3 (0%)
R-SNARE_VAMP2 32..94 CDD:277223 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.