DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Vamp2

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_033523.1 Gene:Vamp2 / 22318 MGIID:1313277 Length:116 Species:Mus musculus


Alignment Length:80 Identity:22/80 - (27%)
Similarity:49/80 - (61%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :.:...|:||:.|||..|:|.:.:|.:||..|.::.:.|...:..|..::..|.|:.:|||:::.
Mouse    32 LQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMM 96

  Fly   191 VVVGLVITFIVYVIV 205
            :::|::...|:.:|:
Mouse    97 IILGVICAIILIIII 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490
Synaptobrevin 122..210 CDD:279324 22/80 (28%)
R-SNARE_VAMP7 124..188 CDD:277224 19/61 (31%)
Vamp2NP_033523.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
R-SNARE_VAMP2 30..92 CDD:277223 17/59 (29%)
Required for interaction with SEPT8. /evidence=ECO:0000250|UniProtKB:P63045 92..116 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.