DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Sec22b

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_035472.1 Gene:Sec22b / 20333 MGIID:1338759 Length:215 Species:Mus musculus


Alignment Length:165 Identity:43/165 - (26%)
Similarity:78/165 - (47%) Gaps:8/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KMTYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQVATAIAYSMNTEF 106
            :.|...|....||..|..:.|:.:.:..|.:..||.:|.|:..:|.:.:|.:|.|........||
Mouse    51 RCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEF 115

  Fly   107 SKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAF 171
            ...:.:....:..||....:..::.::.:::.|||.||:.:..|||.|..|.:|..|||:.|..:
Mouse   116 DTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY 180

  Fly   172 RKASRNLARQMFWKNIR-VYVVVGLVITFIVYVIV 205
            |:.::.|       |:| .|..:..|..|.:.:||
Mouse   181 RQDAKYL-------NMRSTYAKLAAVAVFFIMLIV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 14/54 (26%)
Synaptobrevin 122..210 CDD:279324 24/85 (28%)
R-SNARE_VAMP7 124..188 CDD:277224 18/63 (29%)
Sec22bNP_035472.1 Longin 3..126 CDD:341428 17/74 (23%)
R-SNARE_SEC22 132..195 CDD:277219 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.