DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and snb-6

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_495887.1 Gene:snb-6 / 188497 WormBaseID:WBGene00044062 Length:102 Species:Caenorhabditis elegans


Alignment Length:89 Identity:23/89 - (25%)
Similarity:42/89 - (47%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            |.|...:::.:|.||.:|:..:.:|..||:.||.:.:.|...|..:.|.:..:.|:|.||     
 Worm    18 IMRTRQELNSVKIIMKENVQKIMERQGKLDDLVERAQKLEEASDVYVKCAVKIKREMSWK----- 77

  Fly   191 VVVGLVITFIVYVIVSMACGGLAW 214
              ...:...|:.|....|..|:|:
 Worm    78 --ANAIRNGIIAVSSVSAFAGIAY 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 18/61 (30%)
snb-6NP_495887.1 Synaptobrevin 14..102 CDD:395764 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.