DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and vamp-8

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001040904.1 Gene:vamp-8 / 178349 WormBaseID:WBGene00007200 Length:116 Species:Caenorhabditis elegans


Alignment Length:98 Identity:25/98 - (25%)
Similarity:56/98 - (57%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 REVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWK 185
            ::.:.:..:..|:|.:|.:||.|::.:.:|||:|:.:..::|.|:..|..|:..:|.:.|:....
 Worm    16 QQKEKMQNLRNQVDSVKAVMVDNVERILERGERLDNIERRSEQLNATSANFKFTARKVQRKFCML 80

  Fly   186 NIRVYVVVGLVITFIVYVIVSMACGGLAWQSCV 218
            |.:..|::.:|| .||:|::.:..  |.|...:
 Worm    81 NAKWTVILSIVI-LIVFVVLLLLI--LHWTGVI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 17/63 (27%)
vamp-8NP_001040904.1 Synaptobrevin 17..>88 CDD:395764 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.