Sequence 1: | NP_001286255.1 | Gene: | Vamp7 / 36015 | FlyBaseID: | FBgn0266186 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476488.2 | Gene: | Sec22a / 117513 | RGDID: | 621659 | Length: | 307 | Species: | Rattus norvegicus |
Alignment Length: | 222 | Identity: | 36/222 - (16%) |
---|---|---|---|
Similarity: | 75/222 - (33%) | Gaps: | 61/222 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 KMTYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYG-LQVATAIAYSMNTE 105
Fly 106 FSKILAQQMVYFSQSREVDTISRVHGQIDELK----------------------DIMVKNIDSLR 148
Fly 149 DRGEKLE------------------------------LLVNKTENLSNNSVAFRKASRNLARQMF 183
Fly 184 -------WKNIRVYVVVGLVITFIVYV 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vamp7 | NP_001286255.1 | Longin | 32..97 | CDD:290490 | 13/55 (24%) |
Synaptobrevin | 122..210 | CDD:279324 | 18/141 (13%) | ||
R-SNARE_VAMP7 | 124..188 | CDD:277224 | 15/122 (12%) | ||
Sec22a | NP_476488.2 | Longin | 5..126 | CDD:341428 | 17/75 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |