DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and sec22ba

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_998549.1 Gene:sec22ba / 114464 ZFINID:ZDB-GENE-010724-3 Length:215 Species:Danio rerio


Alignment Length:163 Identity:44/163 - (26%)
Similarity:83/163 - (50%) Gaps:4/163 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KMTYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV-ATAIAYSMNTE 105
            :.|...|....||..|..:.|:.:.:..|.:..||.:|.|::.:|.:.||.:| :.:..||. .|
Zfish    51 RCTLEAGKMCFHYVIEKGVCYLALCEAGFPKKLAFAYLEDLEGEFSEQYGAKVPSVSRPYSF-IE 114

  Fly   106 FSKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVA 170
            |...:.:.:..:..||....:..::.::.:::.|||.||:.:..|||.|..|.:|..|||:.|..
Zfish   115 FDTYIQKTIKSYIDSRARRNLGNINSELHDVQRIMVANIEEVLQRGEALSALDSKASNLSSLSKK 179

  Fly   171 FRKASRNLARQMFWKNIRVYVVVGLVITFIVYV 203
            :|..::.|..:..:..:....|:  :||.|:||
Zfish   180 YRSDAKYLNTRSTYAKVAAGAVI--IITLIIYV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 15/55 (27%)
Synaptobrevin 122..210 CDD:279324 23/82 (28%)
R-SNARE_VAMP7 124..188 CDD:277224 17/63 (27%)
sec22baNP_998549.1 SNC1 10..188 CDD:227472 37/137 (27%)
Longin 37..103 CDD:290490 14/51 (27%)
R-SNARE_SEC22 132..195 CDD:277219 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.