DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and LOC102557303

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_008768297.1 Gene:LOC102557303 / 102557303 RGDID:7709406 Length:214 Species:Rattus norvegicus


Alignment Length:227 Identity:55/227 - (24%)
Similarity:103/227 - (45%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTH-GDYLIHYTCENKLVYMC 64
            |.|.||.::.|..|||:.|...|::.|....::.:..:.....|... |.|:.|....:.:.|:|
  Rat     1 MTITYSCVANGRAVLAELALTGGSYQEAAAKVLRQALLKAEPTTIIQIGSYVYHTLFIDGITYLC 65

  Fly    65 ITDNEFERSRAFLFLADIKQKFIQTYGLQVATAI----------AYSMNTEFSKILAQQMVYFSQ 119
            .|||..:......||..:...|         |.|          :.::.|:|.:||||.|:.:::
  Rat    66 ATDNGLDTMAPSAFLRQVSDIF---------TRIPLMSQEHFFPSNALATDFQQILAQHMMEYNK 121

  Fly   120 SREVDTISRVHGQIDELKDIMVKNIDSLRDR-GEKLELLVNK-------TENLSNNSVAFRKASR 176
            :.....:|.|..|:.::|.||::|||::.:: .|.:.:|..:       .|.|.|        |:
  Rat   122 NGSRMVLSTVKSQVSDVKSIMLRNIDTILEKETETVRILTEEAGDPQATAEELEN--------SK 178

  Fly   177 NLARQMFWKNIRVYVVVGLVITFIVYVIVSMA 208
            .:.::.:||..:: ||..|.|...:.:|:..|
  Rat   179 KMPKRTWWKCFKI-VVTTLAIPLSIIIILLSA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 12/65 (18%)
Synaptobrevin 122..210 CDD:279324 23/95 (24%)
R-SNARE_VAMP7 124..188 CDD:277224 17/71 (24%)
LOC102557303XP_008768297.1 Longin <46..89 CDD:290490 11/51 (22%)
SNARE 128..191 CDD:304603 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.