DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and Zfp429

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001074410.1 Gene:Zfp429 / 72807 MGIID:1920057 Length:485 Species:Mus musculus


Alignment Length:382 Identity:93/382 - (24%)
Similarity:146/382 - (38%) Gaps:72/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EVEPNFSPEK----EQGHDELASNSHHDYISNQPHKAFYSLQRTSPGVIQYFIQQ-----LRRH- 113
            :|..:||||:    |....:|..|.   .:.|..|..|..|..:.|.::.:..|:     ::|. 
Mouse    19 DVAIDFSPEEWECLEPAQWDLYRNV---MLENFSHLVFLGLAVSKPFLVTFLEQRQGPWDMKRQG 80

  Fly   114 ---KFFWITEHGINKKDRMDSSQKVAEALFHRFHFQLDPKVVNASARFLQVWFERQYVMQLSSSD 175
               .:..||.:..|...::.:.:.:. ....|.|....|.......:.|..........:|.:.|
Mouse    81 AATVYPGITPNDPNNYSKLTNCKSLL-ITQRRNHIGEKPYKCGEFGKALSSHKTLSIHQRLHTGD 144

  Fly   176 --FRCRYPKYYH------SLLKFMPTNHISVTI--CEECDRRFLNERLLRLHKFRVHGGPNPNVC 230
              ::|   |..|      |.|.....||....|  ||:|.|.|....:|:.|: |:|.|..|..|
Mouse   145 KPYKC---KECHKAFSTRSSLFIHMKNHTDEKIYKCEDCGRTFYYLSMLKQHQ-RIHSGEKPYKC 205

  Fly   231 HVCHQSFPLASKLEQHQARYHFKRPEWQCSRCDYNAPSKWDFQQHQ------------------- 276
            ..|.:.|...|.|:||| |.|.::..:....|....|.....|:|:                   
Mouse   206 EECGKCFGFPSFLKQHQ-RLHCRKNAYMYEECVKRFPPPLPLQEHEQIRTEEKPYKCGERYKTFR 269

  Fly   277 ---------AMHAGQRNYICELCGHSSKTSSALAVHRRTH--DQPKLCCPHCSRQFRENSTLKSH 330
                     |:|.|:|.|.||.||....:||.|..|:..|  |.| ..|..|.:.||.:|.|:.|
Mouse   270 YHSALRIHKAVHTGERPYKCEECGKCFSSSSCLKKHQILHSEDNP-YKCEECYKAFRNHSALRIH 333

  Fly   331 IRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVHLQSEEMESYEDDDPEELNRFVS 387
             :.:|.|.  |...|..|.:.:.:...||.|:::|      ..|.....||..:.:|
Mouse   334 -KTVHTGE--RPYKCKDCGKCYSSSSCLKRHQILH------SKYNPYKCEECGKCLS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 10/35 (29%)
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..279 CDD:275368 5/47 (11%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
Zfp429NP_001074410.1 KRAB 15..74 CDD:214630 14/57 (25%)
KRAB 15..54 CDD:279668 10/37 (27%)
C2H2 Zn finger 97..113 CDD:275368 1/16 (6%)
C2H2 Zn finger 121..141 CDD:275368 1/19 (5%)
zf-H2C2_2 134..158 CDD:290200 5/26 (19%)
COG5048 144..>461 CDD:227381 70/253 (28%)
C2H2 Zn finger 149..169 CDD:275368 5/22 (23%)
C2H2 Zn finger 177..197 CDD:275368 8/20 (40%)
zf-H2C2_2 189..212 CDD:290200 8/23 (35%)
C2H2 Zn finger 205..225 CDD:275368 9/20 (45%)
zf-H2C2_2 273..298 CDD:290200 9/24 (38%)
C2H2 Zn finger 289..309 CDD:275368 8/19 (42%)
C2H2 Zn finger 317..337 CDD:275368 7/20 (35%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
C2H2 Zn finger 373..393 CDD:275368 3/9 (33%)
C2H2 Zn finger 401..421 CDD:275368
C2H2 Zn finger 429..449 CDD:275368
zf-H2C2_2 441..464 CDD:290200
C2H2 Zn finger 457..477 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.