DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and ZNF691

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001229668.1 Gene:ZNF691 / 51058 HGNCID:28028 Length:315 Species:Homo sapiens


Alignment Length:168 Identity:57/168 - (33%)
Similarity:83/168 - (49%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ICEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKLEQHQARYHFKRPEWQCSRCDY 264
            ||.:|.:.|.|...||.|: |:|.|..|..|..|.:||..:|...:|: |.|.:...::|.:|..
Human   116 ICAQCGKTFNNTSNLRTHQ-RIHTGEKPYKCSECGKSFSRSSNRIRHE-RIHLEEKHYKCPKCQE 178

  Fly   265 NAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTHDQPK--LCCPHCSRQFRENSTL 327
            :...:.|...||..|.|:|.|.|::||.|...|:.||||.|||.:|.  :|| .|.:.|..:|:.
Human   179 SFRRRSDLTTHQQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICC-ECGKSFSNSSSF 242

  Fly   328 KSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVH 365
            ..| .:.|.|.  |...|..|.|.|..:.....|:..|
Human   243 GVH-HRTHTGE--RPYECTECGRTFSDISNFGAHQRTH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
C2H2 Zn finger 287..307 CDD:275368 10/19 (53%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
ZNF691NP_001229668.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
COG5048 <108..266 CDD:227381 55/155 (35%)
C2H2 Zn finger 117..137 CDD:275368 8/20 (40%)
C2H2 Zn finger 145..165 CDD:275368 7/20 (35%)
C2H2 Zn finger 173..193 CDD:275368 5/19 (26%)
C2H2 Zn finger 201..221 CDD:275368 10/19 (53%)
C2H2 Zn finger 229..249 CDD:275368 6/21 (29%)
C2H2 Zn finger 257..277 CDD:275368 5/19 (26%)
zf-C2H2 283..305 CDD:306579
C2H2 Zn finger 285..305 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.