DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and CG4360

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster


Alignment Length:203 Identity:48/203 - (23%)
Similarity:71/203 - (34%) Gaps:67/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 NHISVTI------CEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKL--------- 243
            ||:.:..      |:.||:.|.....|..| .::|.|..|..|::|.:.|...|.|         
  Fly   159 NHMKIHTDERPYKCKHCDKAFRQISTLTNH-VKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKA 222

  Fly   244 -------------------------------EQHQ----------------ARYHFKRPEWQCSR 261
                                           :|||                |.....:| :|||.
  Fly   223 AESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKP-FQCSV 286

  Fly   262 CDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTH--DQPKLCCPHCSRQFREN 324
            |....|.......|:..|...:.|.||.|..|....:.||.|::.|  |:| ..|.:|..|||:.
  Fly   287 CKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKP-YTCSYCHMQFRQQ 350

  Fly   325 STLKSHIR 332
            |||.:|::
  Fly   351 STLTNHLK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
C2H2 Zn finger 287..307 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..335 CDD:275368 9/19 (47%)
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 2/4 (50%)
zf-H2C2_2 157..181 CDD:290200 6/21 (29%)
C2H2 Zn finger 172..192 CDD:275368 6/20 (30%)
zf-H2C2_2 185..209 CDD:290200 8/24 (33%)
C2H2 Zn finger 200..220 CDD:275368 5/19 (26%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-C2H2_8 287..363 CDD:292531 24/73 (33%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 9/19 (47%)
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 491..515 CDD:290200
C2H2 Zn finger 506..526 CDD:275368
zf-H2C2_2 519..543 CDD:290200
C2H2 Zn finger 534..554 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.