DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and Zfp874b

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_006517346.1 Gene:Zfp874b / 408067 MGIID:3040702 Length:451 Species:Mus musculus


Alignment Length:403 Identity:98/403 - (24%)
Similarity:155/403 - (38%) Gaps:101/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SFKNVEFMEEEVEPNFSPEKEQGHDELASNSHHD-YISNQPHKAFYSLQRTSPGVIQYFIQQ--- 109
            ||::|..       :||||:.........:.:.| .:.|..|..|..|....|.::.:..|.   
Mouse    10 SFRDVAI-------DFSPEERDYLGPAQWDLYRDVMLENYSHLVFLGLAVAKPYLVTFLEQNQGS 67

  Fly   110 --LRRHKFFWI---TEHGINKKDRMDSSQKVAEALFH--------RFHFQLDP-------KVVNA 154
              ::.|....|   |.:..|..:         ||:.|        |.|...:|       |.:::
Mouse    68 SGVKSHAAATIPGTTGNEFNNHN---------EAIDHSSLSMQCQRIHTGEEPYYFEDCGKALSS 123

  Fly   155 SARFLQVWFERQYVMQLSSSD--FRCR--------------YPKYYHSL---------LKFMPTN 194
            .|. |.| .:|:|     |.|  ::|:              :.||:...         .:|:.::
Mouse   124 QAT-LSV-LQRRY-----SGDKPYKCKECHKTLSSRSSLLIHQKYHTDEKTYKCEKCGKRFLRSS 181

  Fly   195 HI----------SVTICEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKLEQHQAR 249
            |:          ....|||||:.||:...||.|: .||.|..|..|..|..||...:.|:||| |
Mouse   182 HLQHHQKIHTGEKPYKCEECDKAFLHHSYLRKHQ-AVHTGEKPYKCEECGNSFYYPAMLKQHQ-R 244

  Fly   250 YHFKRPEWQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTHD-QPKLC 313
            .|......:|..|.....|.:...||:.:.:.::.|.|:.||.|....|.|..|.|.|. :....
Mouse   245 IHSGEKLDKCEECGKVFSSAFFLNQHKGIDSIEKRYKCQECGKSFCYRSYLREHYRRHSGEYPYK 309

  Fly   314 CPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVHLQSEEMESYEDDD 378
            |..|.:.|..:|.|:.| :.||.|  .:...|:.|.:.|.:...||.|:::|         .:|.
Mouse   310 CEECGKGFSRSSKLQEH-QTIHTG--VKPYKCEECEKCFSSFTSLKRHQIIH---------SEDT 362

  Fly   379 PEEL----NRFVS 387
            |.|.    .||.|
Mouse   363 PHECVECGKRFSS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 10/42 (24%)
C2H2 Zn finger 201..222 CDD:275368 10/20 (50%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
Zfp874bXP_006517346.1 KRAB 9..63 CDD:214630 13/59 (22%)
C2H2 Zn finger 115..134 CDD:275368 5/20 (25%)
C2H2 Zn finger 142..162 CDD:275368 2/19 (11%)
COG5048 <147..427 CDD:227381 65/243 (27%)
C2H2 Zn finger 170..190 CDD:275368 2/19 (11%)
C2H2 Zn finger 198..218 CDD:275368 10/20 (50%)
C2H2 Zn finger 226..246 CDD:275368 9/20 (45%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
C2H2 Zn finger 310..330 CDD:275368 6/20 (30%)
C2H2 Zn finger 338..358 CDD:275368 6/19 (32%)
C2H2 Zn finger 366..386 CDD:275368 3/10 (30%)
C2H2 Zn finger 394..414 CDD:275368
C2H2 Zn finger 422..442 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.