DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and ZNF429

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_016882237.1 Gene:ZNF429 / 353088 HGNCID:20817 Length:689 Species:Homo sapiens


Alignment Length:394 Identity:87/394 - (22%)
Similarity:142/394 - (36%) Gaps:73/394 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HGNESGFNADEDEIQDEVQVEMTNLLAASIAQESKLAEVQESFKNVEFMEEEVEPNFSPEKEQGH 72
            |..|..:..||.                     .|...:..:|...:.:..|.:|....|..:..
Human   294 HSGEKPYKCDEC---------------------GKTFSISSTFTKHKIIHTEEKPYKCKECGKAF 337

  Fly    73 DELASNSHHDYI--SNQPHKAFYSLQRTSPGVIQYFIQQLRRHKFFWITE---------HGINKK 126
            :..::.:.|..|  ..:|:|.      ...|....:...|.:||.....|         ...|:.
Human   338 NRSSTLTSHKRIHTGEKPYKC------EECGKAFNWSSTLTKHKVIHTGEKPYKCEECGKAFNQS 396

  Fly   127 DRMDSSQKVAEALFHR----FHFQLDPKVVNASARFLQ----VWFERQYVMQLSSSDFRCRYPKY 183
            .|:...:|:     |.    :.|:...:|...|:...|    ...|:.|..:      .|.....
Human   397 SRLTRHKKI-----HTGEEPYKFEKCGRVFTCSSTLTQDKKIHTGEKPYNCE------ECGKVFT 450

  Fly   184 YHSLLKFMPTNHISVTI------CEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASK 242
            |.|.|    |.|..:..      |.||.:.|.....|..|: |:|.|..|..|..|.::|..:|.
Human   451 YSSTL----TRHKRIHTEEKPYKCNECGKAFNRSSHLTSHR-RIHTGEKPYKCEECGKAFKQSSN 510

  Fly   243 LEQHQARYHFKRPEWQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTH 307
            |..|:..:..::| ::|..|...........||:.:|.|::.|.||.||.:...||.|..|::.|
Human   511 LNSHKKIHSGEKP-YKCEECGKAFILSSRLTQHKKIHTGEKPYKCEECGKAFNRSSRLTQHKKIH 574

  Fly   308 DQPK-LCCPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVHLQSEEM 371
            ...| ..|..|.:.|..:|.|.|| :|||.|.  :...|:.|.:.|.....|..||.:|.:.:..
Human   575 TGEKPYKCKQCDKAFTHSSNLSSH-KKIHSGE--KPYKCEECGKAFNRSSRLTQHKKIHTREKPY 636

  Fly   372 ESYE 375
            :..|
Human   637 KCEE 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 8/59 (14%)
C2H2 Zn finger 201..222 CDD:275368 7/20 (35%)
C2H2 Zn finger 259..279 CDD:275368 4/19 (21%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..335 CDD:275368 8/20 (40%)
ZNF429XP_016882237.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.