DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1663 and Zfp455

DIOPT Version :9

Sequence 1:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001041669.1 Gene:Zfp455 / 218311 MGIID:3040708 Length:461 Species:Mus musculus


Alignment Length:410 Identity:93/410 - (22%)
Similarity:152/410 - (37%) Gaps:110/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MEE-----EVEPNFSPEKEQGHDELASNSHHD-YISNQPHKAFYSLQRTSPGVIQYFIQQ----- 109
            |||     :|..:||||:.:..:....:.:.| .:.|..|..|..|..:.|.::.:..|:     
Mouse     1 MEEMLSFWDVAIDFSPEEWECLEPAQWDLYRDVMLENFSHLVFLGLAVSKPFLVTFLEQRQGPWD 65

  Fly   110 LRRHKFFWITEHGINKKDRMDSSQ--KVAEALFHRFHFQLDPKVVN--------ASARFLQV--- 161
            ::|.....:.. ||...|..:.|:  .....|..|....:..|..|        :|.:.|.:   
Mouse    66 MKRQAAATVYP-GIIPNDPNNYSKFTNCKSLLIKRRRIHIGEKPYNCGECGKALSSHKTLSIHQR 129

  Fly   162 --WFERQYVMQLSSSDFRCRYPKYYHSLLKFMPTNHISVTI--CEECDRRFLNERLLRLHKFRVH 222
              ..::.|..:.....|..|...:.|.      .||....|  ||||.:.|....:|:.|: |:|
Mouse   130 LHTGDKPYKCEECHKAFSTRSSLFIHM------KNHTDEKIYKCEECGKTFYYPSMLKQHQ-RIH 187

  Fly   223 GGPNPNVCHVCHQSFPLASKLEQHQ---------------------------ARYHFKRPEWQCS 260
            .|..|..|..|.:||...|.|:|||                           .:.|.:...::|.
Mouse   188 SGEKPCKCEECGKSFGFPSFLKQHQRIHCRKNAYKDEICVKRLSPPLPLQEHEQIHTEEKPYKCG 252

  Fly   261 RCDYNAPSKWDFQQHQAM------HAGQRNYICELCGHSSKTSSALAVHRRTH--DQPKLC---- 313
            .| |.|     |:.|.|:      |.|::.|.||.|.....:||.|..|:..|  |.|..|    
Mouse   253 EC-YKA-----FRYHSALRIHKTVHTGEKPYKCEECSRCFSSSSCLKRHQILHSEDNPYKCEECG 311

  Fly   314 -----------------------CPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTL 355
                                   |..|.::|..:::|:.| :.||.|.  :..:|:.|.:.|:..
Mouse   312 RCFCSSSSLRRHQTFHSEDNPYKCEECDKRFSCSASLQEH-QTIHTGE--KPYTCENCHKAFRYH 373

  Fly   356 ELLKLHKLVHLQSEEMESYE 375
            ..|:.||.||.:.   :||:
Mouse   374 SSLRRHKTVHTRE---KSYK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 11/40 (28%)
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..279 CDD:275368 7/25 (28%)
C2H2 Zn finger 287..307 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
Zfp455NP_001041669.1 KRAB 5..64 CDD:214630 12/58 (21%)
KRAB 5..44 CDD:279668 8/38 (21%)
C2H2 Zn finger 87..103 CDD:275368 3/15 (20%)
C2H2 Zn finger 111..131 CDD:275368 2/19 (11%)
zf-H2C2_2 124..148 CDD:290200 3/23 (13%)
COG5048 134..>420 CDD:227381 67/276 (24%)
C2H2 Zn finger 139..159 CDD:275368 3/25 (12%)
C2H2 Zn finger 167..187 CDD:275368 8/20 (40%)
zf-H2C2_2 179..202 CDD:290200 8/23 (35%)
C2H2 Zn finger 195..215 CDD:275368 9/19 (47%)
C2H2 Zn finger 251..271 CDD:275368 7/25 (28%)
C2H2 Zn finger 307..327 CDD:275368 1/19 (5%)
C2H2 Zn finger 335..355 CDD:275368 5/20 (25%)
zf-H2C2_2 347..372 CDD:290200 8/27 (30%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
C2H2 Zn finger 391..411 CDD:275368 93/410 (23%)
C2H2 Zn finger 419..439 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.