| Sequence 1: | NP_724824.1 | Gene: | CG1648 / 36009 | FlyBaseID: | FBgn0033446 | Length: | 232 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_188379.1 | Gene: | AT3G17520 / 821017 | AraportID: | AT3G17520 | Length: | 298 | Species: | Arabidopsis thaliana |
| Alignment Length: | 161 | Identity: | 30/161 - (18%) |
|---|---|---|---|
| Similarity: | 47/161 - (29%) | Gaps: | 66/161 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 PLVFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCE 111
Fly 112 NIPIVL----------------------CGN--KVDIKDRKVKAKSIVFH------------RKK 140
Fly 141 NLQYYDI-----SAKSN--------YNFEKP 158 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1648 | NP_724824.1 | PTZ00121 | <23..>214 | CDD:173412 | 30/161 (19%) |
| AT3G17520 | NP_188379.1 | PTZ00121 | <69..>277 | CDD:173412 | |
| Blue background indicates that the domain is not in the aligned region. | |||||