DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1648 and AT3G17520

DIOPT Version :10

Sequence 1:NP_724824.1 Gene:CG1648 / 36009 FlyBaseID:FBgn0033446 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_188379.1 Gene:AT3G17520 / 821017 AraportID:AT3G17520 Length:298 Species:Arabidopsis thaliana


Alignment Length:161 Identity:30/161 - (18%)
Similarity:47/161 - (29%) Gaps:66/161 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PLVFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCE 111
            |.||...|.....|....:||||                 ::|:.|.....:.|.|...::....
plant   635 PTVFAIVRYKPSVNCGPFSGQEK-----------------IYDIISETIKTDFPAWFNKVMSYVS 682

  Fly   112 NIPIVL----------------------CGN--KVDIKDRKVKAKSIVFH------------RKK 140
            :..:||                      ..|  :..::..:::.|..||.            .||
plant   683 SPVVVLPALLLLFMLIYYLQSIARSLKFTNNQLRTQLQTERIEDKKKVFQMAIARLQNKDGCEKK 747

  Fly   141 NLQYYDI-----SAKSN--------YNFEKP 158
            .....||     ||:|:        .|||.|
plant   748 TEPDSDIISQESSARSSTPRKNGSVVNFESP 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1648NP_724824.1 PTZ00121 <23..>214 CDD:173412 30/161 (19%)
AT3G17520NP_188379.1 PTZ00121 <69..>277 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.