DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1698 and CG31904

DIOPT Version :9

Sequence 1:NP_001260835.1 Gene:CG1698 / 36006 FlyBaseID:FBgn0033443 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:232 Identity:66/232 - (28%)
Similarity:92/232 - (39%) Gaps:35/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KKRDSWNNDIEF-LMSCIALSVGLGNVWRFPFTALENGGGAFVIPYLIVLILVGKPVYYLEMLLG 135
            |.|..|....:| ..||......|.......|..|..|...|:|.||:.::....|::.::..||
  Fly    82 KCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLG 146

  Fly   136 QFSSRGSVKVYDFSPIMRGIGYGQVLATGIVTTYYATLMALTLRYFVDSFYPTLPWSYCREEWGT 200
            ||||.|::..:..:||.:||||..:|......|||:....:.|.|.|:|.:|.:||..|...|.|
  Fly   147 QFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNT 211

  Fly   201 ECLDSGPQEASRATSLAGSGVRTTSAEFYFTNIILREKASIDDGIGYPSWSLALALAVAWIVIAG 265
                   ||.|                       |.|...:|..:.. .::||||:.|...||. 
  Fly   212 -------QECS-----------------------LHENYDVDFAVAV-IFTLALAMGVQSSVIP- 244

  Fly   266 IMFKGVKSSGKASYFLALFPYVVMLVLLVRALTLPGA 302
             :...|...| .||.....|.||.....|.|...|.|
  Fly   245 -LLSQVAGHG-LSYTAVSGPAVVASPWAVPAAHWPAA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1698NP_001260835.1 SLC6sbd 75..552 CDD:271359 64/229 (28%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 43/150 (29%)
Cuticle_4 276..344 CDD:292577 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.