DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kch

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_415766.1 Gene:kch / 945841 ECOCYCID:EG11606 Length:417 Species:Escherichia coli


Alignment Length:185 Identity:35/185 - (18%)
Similarity:66/185 - (35%) Gaps:50/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSL-GALLADGLQCTYVR 255
            |...|..:|:..::|:|:|.:.|.:.:.:|.||...:.|:.:....::|: |.|:..|.     .
E. coli   171 SLMTAFYFSIETMSTVGYGDIVPVSESARLFTISVIISGITVFATSMTSIFGPLIRGGF-----N 230

  Fly   256 LCCQLQRHQEHRRKSTPGTSTPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSETSLNDCLE 320
            ...:...|..||                           |.....|       .:|..::|..|:
E. coli   231 KLVKGNNHTMHR---------------------------KDHFIVC-------GHSILAINTILQ 261

  Fly   321 YGQKGKLPPDKKEGDACQLLRNLNPQQHFYQQQQQQPQQPDVMLMTTTSGSALLK 375
            ..|:|:         ...::.|| |:....|.:|:.....||:...:...|.|.|
E. coli   262 LNQRGQ---------NVTVISNL-PEDDIKQLEQRLGDNADVIPGDSNDSSVLKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 14/55 (25%)
Ion_trans_2 822..896 CDD:462301
kchNP_415766.1 PRK10537 3..402 CDD:236711 35/185 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.