DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK6

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:180 Identity:54/180 - (30%)
Similarity:79/180 - (43%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCL-RELWIITEKLNVLYERNWTMLVHE 141
            |.:.....|.|||.||...||.|.:....|.:...|...| |...:....|:...||   :|...
Human     9 GALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVER---VLAAG 70

  Fly   142 QLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITT 206
            :|    |.:|.|...|||.:|                         ..:|.|:.||.::.|:|||
Human    71 RL----GRVVLANASGSANAS-------------------------DPAWDFASALFFASTLITT 106

  Fly   207 IGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRL 256
            :|:|..||.|.|||..:|.:||:|||..::.|::....|:  |..|:|.|
Human   107 VGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTASAQRLS--LLLTHVPL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
KCNK6NP_004814.1 Ion_trans_2 <91..146 CDD:285168 23/54 (43%)
Ion_trans_2 180..256 CDD:285168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10857
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4753
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.