Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113648.2 | Gene: | KCNK17 / 89822 | HGNCID: | 14465 | Length: | 332 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 58/199 - (29%) |
---|---|---|---|
Similarity: | 89/199 - (44%) | Gaps: | 52/199 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 AKPRSSLRRCCGHLLKLLFSTPGLVLLV---IGYSVLGGLLFPLLE--APQDISKSAAIAKSRED 115
Fly 116 CLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGH 180
Fly 181 FGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALL 245
Fly 246 ADGL 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | 27/55 (49%) |
Ion_trans_2 | 822..896 | CDD:285168 | |||
KCNK17 | NP_113648.2 | Ion_trans_2 | 96..157 | CDD:285168 | 28/70 (40%) |
Ion_trans_2 | <203..268 | CDD:285168 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 287..312 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X19 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.910 |