DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK17

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_113648.2 Gene:KCNK17 / 89822 HGNCID:14465 Length:332 Species:Homo sapiens


Alignment Length:199 Identity:58/199 - (29%)
Similarity:89/199 - (44%) Gaps:52/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AKPRSSLRRCCGHLLKLLFSTPGLVLLV---IGYSVLGGLLFPLLE--APQDISKSAAIAKSRED 115
            |.|...:|.|         :.|..|||:   :.|..||..:|..||  |.||.|:|..       
Human     8 AAPEGRVRGC---------AVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQ------- 56

  Fly   116 CLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGH 180
              |:.|.:.:        |:|.|....|......:|.|.:.|::..|           :.:::|.
Human    57 --RDKWELLQ--------NFTCLDRPALDSLIRDVVQAYKNGASLLS-----------NTTSMGR 100

  Fly   181 FGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALL 245
                      |....:..:||:.|||||:|:|:|.|.|.:|..||:||||:||.|:.|:.||.|:
Human   101 ----------WELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLM 155

  Fly   246 ADGL 249
            ..|:
Human   156 QQGV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 27/55 (49%)
Ion_trans_2 822..896 CDD:285168
KCNK17NP_113648.2 Ion_trans_2 96..157 CDD:285168 28/70 (40%)
Ion_trans_2 <203..268 CDD:285168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.