DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and TOK1

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:37/138 - (26%)
Similarity:63/138 - (45%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 GTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCDGK---DCREAEDSEEEDEKADGRQ---V 815
            |.:...|.:..:.|....:..|..|:...|..:::.|..   ..|||.|..:...:...|:   .
Yeast   316 GLIVFMTRSIIQKSSGPIFFFHRVEKGRSKSWKHYMDSSKNLSEREAFDLMKCIRQTASRKQHWF 380

  Fly   816 PISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLYACCA 880
            .:|:.:.|..::..:|.::|...||||..:..||||:.|.||||||:.|..........::|..|
Yeast   381 SLSVTIAIFMAFWLLGALVFKFAENWSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGA 445

  Fly   881 YLLLGLVL 888
            ..|:|.:|
Yeast   446 VPLMGAIL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 24/67 (36%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301 2/11 (18%)
Ion_trans_2 388..462 CDD:400301 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.