DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and TPK4

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:107 Identity:29/107 - (27%)
Similarity:46/107 - (42%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 EDSEEEDE---KADGRQVPISLVLLILASYICVGTVIFALW-------ENWSLVDGAYFCFVTLS 855
            |.|.||.:   .:..:...:.|.:::|..|:..|...::.:       |....||..||..||.|
plant    16 ESSPEETQVTTVSKSKWTILVLAMILLLVYLTFGVCTYSFFRDQFSGTETNLFVDAFYFSIVTFS 80

  Fly   856 TIGYGDFVPARSFNGPELQLYACCAYLLLGLVLVAMSFSILE 897
            |:||||.||:.|            ...:|.:|||:.....|:
plant    81 TVGYGDIVPSTS------------TTKILTIVLVSTGVVFLD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 23/80 (29%)
TPK4NP_171752.1 Ion_trans_2 40..118 CDD:285168 24/83 (29%)
Ion_trans_2 169..233 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.