DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCO1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:130 Identity:40/130 - (30%)
Similarity:64/130 - (49%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 DCREAEDSEEEDEKADGRQVP--------ISLVLLILASYICVGTVIFAL-------WENWSLVD 845
            ||...:|.:.::......::|        :..|::.||.|:.:||:.|.|       .:...:||
plant    47 DCMYNDDVKIDEPPPHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVVD 111

  Fly   846 GAYFCFVTLSTIGYGDFVPARSFNGPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIAVR 910
            ..|||.||::|:||||.||    |....:|.| ||::..|:|||....|.....|:.|.:.:.||
plant   112 ALYFCIVTMTTVGYGDLVP----NSSASRLLA-CAFVFSGMVLVGHLLSRAADYLVEKQEALLVR 171

  Fly   911  910
            plant   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 31/80 (39%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 32/86 (37%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.