DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCO3

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001190480.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:179 Identity:41/179 - (22%)
Similarity:71/179 - (39%) Gaps:59/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 GTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCD--GKDCREAEDSEEEDEKADGRQVPISL 819
            |:|..|:::.|:....|..:...     |..|..|.|  ..|....:::|:...|:..||   :|
plant    15 GSLPRSSSDPTDLQFTEPNVPPS-----LFSLPEHNDDTATDMAPDQETEQSVSKSIARQ---AL 71

  Fly   820 VLLILASYICVGTVIFALWENWSLV--DGAY---------------------------------F 849
            .||::  |:.:|.:|:     |..:  |.||                                 |
plant    72 ALLVV--YLSLGVLIY-----WLTLDSDNAYQTHPVAVALYFFVVTFCGFLIVHFVVKIGWLDSF 129

  Fly   850 CF--VTLSTIGYGDFVPARSFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
            ||  :.::|:|:||    |:|| ..|..:....:||:..:.||.:|..|
plant   130 CFSVMMVTTVGFGD----RAFN-TWLGTFLAAVWLLVSTLAVARAFLFL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 24/110 (22%)
KCO3NP_001190480.1 Ion_trans_2 104..176 CDD:285168 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.