DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCO3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_199448.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:179 Identity:41/179 - (22%)
Similarity:71/179 - (39%) Gaps:59/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 GTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCD--GKDCREAEDSEEEDEKADGRQVPISL 819
            |:|..|:::.|:....|..:...     |..|..|.|  ..|....:::|:...|:..||   :|
plant    15 GSLPRSSSDPTDLQFTEPNVPPS-----LFSLPEHNDDTATDMAPDQETEQSVSKSIARQ---AL 71

  Fly   820 VLLILASYICVGTVIFALWENWSLV--DGAY---------------------------------F 849
            .||::  |:.:|.:|:     |..:  |.||                                 |
plant    72 ALLVV--YLSLGVLIY-----WLTLDSDNAYQTHPVAVALYFFVVTFCGFLIVHFVVKIGWLDSF 129

  Fly   850 CF--VTLSTIGYGDFVPARSFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
            ||  :.::|:|:||    |:|| ..|..:....:||:..:.||.:|..|
plant   130 CFSVMMVTTVGFGD----RAFN-TWLGTFLAAVWLLVSTLAVARAFLFL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 24/110 (22%)
KCO3NP_199448.1 Ion_trans_2 106..176 CDD:462301 17/73 (23%)
FRQ1 <199..>260 CDD:444056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.