DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnc4

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001182125.1 Gene:kcnc4 / 799410 ZFINID:ZDB-GENE-060503-773 Length:603 Species:Danio rerio


Alignment Length:166 Identity:35/166 - (21%)
Similarity:62/166 - (37%) Gaps:41/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLM----CLSSLGALLADGLQCTYVRLCCQ 259
            ::|..:||:|:|.:.|:|..|.:.....|:.||..:.|    .:::.|         .|..|...
Zfish   407 WAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFG---------MYYSLAMA 462

  Fly   260 LQRHQEHRRKSTP-----------GTSTPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSET 313
            .|:..:.::|..|           |.|  .::|..||.:.||             |  ..|..|.
Zfish   463 KQKLPKKKKKHNPNPGMVLDSGSFGKS--ESNSPRNSTQSDT-------------C--PLAAEEN 510

  Fly   314 SLNDCLEYGQKGKLPPDKKEGDACQLLRNLNPQQHF 349
            ...:..:..|.|.......|.:.|.|.:.|:|.:.:
Zfish   511 ITRNRSDSKQNGDATVTLSEEEGCSLTQPLSPGERW 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 13/51 (25%)
Ion_trans_2 822..896 CDD:462301
kcnc4NP_001182125.1 amino terminal assembly domain 1..206
Potassium_chann 1..29 CDD:431870
BTB_KCNC2_4 35..151 CDD:349722
Ion_trans 205..461 CDD:459842 15/62 (24%)
S1-S6 membrane domain 207..516 28/134 (21%)
post S6 proximal carboxyl terminal domain 517..581 7/30 (23%)
distal carboxyl terminus 582..603
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.