DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcna1a

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_005163101.1 Gene:kcna1a / 795942 ZFINID:ZDB-GENE-110408-15 Length:492 Species:Danio rerio


Alignment Length:133 Identity:30/133 - (22%)
Similarity:55/133 - (41%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 DAGDSQSW--SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLA 246
            :|.:.:|:  |..:|..::|..:||:|:|.:.|.|..||:.....|:.||    :.::....::.
Zfish   345 EAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGV----LTIALPVPVIV 405

  Fly   247 DGLQCTYVRLCCQLQRHQE---HRRKSTPGTSTPSASSAANSREKDTDKRSKRRMANCKGCQYDA 308
            ......|         |:|   ..:......|.|:.:|.:||..:.:...||.......|   |.
Zfish   406 SNFNYFY---------HRETEGEEQAQLLNVSNPNIASDSNSSRRSSSTVSKSEYMEIDG---DI 458

  Fly   309 ANS 311
            .||
Zfish   459 NNS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 16/64 (25%)
Ion_trans_2 822..896 CDD:462301
kcna1aXP_005163101.1 BTB_POZ 34..160 CDD:453885
Ion_trans 163..415 CDD:459842 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.