DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk16

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_083282.1 Gene:Kcnk16 / 74571 MGIID:1921821 Length:292 Species:Mus musculus


Alignment Length:214 Identity:64/214 - (29%)
Similarity:100/214 - (46%) Gaps:52/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PRSSLRRCC-GHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELW 121
            ||:.:..|. |.:|.||       |..|.|.:||..:|.|||       ..|.|:||:.      
Mouse     2 PRAGVCGCWGGQVLPLL-------LAYICYLLLGATIFQLLE-------KQAEAQSRDQ------ 46

  Fly   122 IITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAG 186
            ...|||..|  .|:|.|..:.|.:|...|:.|..:           |:..:|:::          
Mouse    47 FQLEKLRFL--ENYTCLDQQALEQFVQVILEAWVK-----------GVNPKGNST---------- 88

  Fly   187 DSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQC 251
            :..:|.|..:..::.||:||||:|:|.|.|.||::..:||||:|:||.::.|:.||.    ||:.
Mouse    89 NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNHLGT----GLRA 149

  Fly   252 TYVRLCCQLQRHQEHRRKS 270
            ...    .|.|.::|.|.|
Mouse   150 HLT----TLDRWEDHPRHS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
Kcnk16NP_083282.1 Ion_trans_2 <92..148 CDD:285168 25/59 (42%)
Ion_trans_2 180..248 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9871
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.