DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcng4

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_080010.2 Gene:Kcng4 / 66733 MGIID:1913983 Length:506 Species:Mus musculus


Alignment Length:100 Identity:22/100 - (22%)
Similarity:44/100 - (44%) Gaps:21/100 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRH 263
            :::..:||:|:|.:.||:..|::..:...|.|:.:|        |..|..:..|:.....:|:|.
Mouse   409 WAIISMTTVGYGDMVPRSVPGQMVALSSILSGILIM--------AFPATSIFHTFSHSYLELKRE 465

  Fly   264 QEHRRKSTPGTSTPSASSAANSREKDTDKRSKRRM 298
            ||.             ..|...|.::|:..|:|.:
Mouse   466 QEQ-------------VQARLRRLQNTNSASEREL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 11/47 (23%)
Ion_trans_2 822..896 CDD:462301
Kcng4NP_080010.2 BTB_POZ 58..167 CDD:453885
Ion_trans 219..463 CDD:459842 13/61 (21%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 416..421 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.