DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnv1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_067729.1 Gene:Kcnv1 / 60326 RGDID:621264 Length:503 Species:Rattus norvegicus


Alignment Length:123 Identity:34/123 - (27%)
Similarity:57/123 - (46%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQ-- 261
            ::.|.:||:|:|.:.|.|..||:......|.|:.::.:.:    |::.|.....|..|  :|:  
  Rat   388 WATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVLALPI----AIINDRFSACYFTL--KLKEA 446

  Fly   262 --RHQEHRRKSTPGTSTPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSETSLND 317
              |.:|..:|.|...:|.|..| .|.|  |...||...|...||  .:.|::.:|..|
  Rat   447 AVRQREALKKLTKNIATDSYIS-VNLR--DIYARSIMEMLRLKG--RERASTRSSGGD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 12/47 (26%)
Ion_trans_2 822..896 CDD:462301
Kcnv1NP_067729.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
BTB_POZ 44..163 CDD:453885
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..192
Ion_trans 212..438 CDD:459842 13/53 (25%)
Selectivity filter. /evidence=ECO:0000250 395..400 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.