DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnv2b

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001122212.1 Gene:kcnv2b / 567780 ZFINID:ZDB-GENE-060526-28 Length:527 Species:Danio rerio


Alignment Length:141 Identity:27/141 - (19%)
Similarity:57/141 - (40%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 YDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKL---ATIFYALV--GVPLMLMCLSSLG 242
            ||...:...|...:..::...|:|:|:|.:.|.|..|::   ..|.:.::  |:|:         
Zfish   414 YDVPKTNFTSIPHSWWWASVSISTVGYGDMYPETLLGRIFAFGCISFGIILNGLPI--------- 469

  Fly   243 ALLADGLQCTYVRLCCQLQRHQEHRRKSTPGTSTPSASSAANSREKDTDKRSKRRMANCKGC--Q 305
            ::|.:.....|.:    |:.|:             ..|...|....:...|:|:::..| ||  .
Zfish   470 SILFNKFSDYYAK----LKSHE-------------CPSHMKNRGNVNFIPRAKKKLREC-GCIET 516

  Fly   306 YDAANSETSLN 316
            .|..|.:|:::
Zfish   517 NDDTNDDTNVS 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 14/68 (21%)
Ion_trans_2 822..896 CDD:462301
kcnv2bNP_001122212.1 BTB_POZ 82..189 CDD:453885
Ion_trans 241..484 CDD:459842 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.