DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK12

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_071338.1 Gene:KCNK12 / 56660 HGNCID:6274 Length:430 Species:Homo sapiens


Alignment Length:182 Identity:45/182 - (24%)
Similarity:70/182 - (38%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 GSEQFVLKKLRYHCDG--------------------KDCREAE--------------DSEEEDEK 809
            |.:.|::....:.|.|                    :.|||.:              .:..|.:.
Human   141 GGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADS 205

  Fly   810 ADGRQVPISLVLLILASYI----CVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPA----- 865
            ..|.:..:..|||||..:.    |..:.::...|.|..||..||||||.||||:||.|.:     
Human   206 LAGWKPSVYHVLLILGLFAVLLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAY 270

  Fly   866 ------RSFNGPELQLYACCAYLLLGLVLVAMSFSILETQLM-WKCKRIAVR 910
                  |..|...:.|..||.|.|..::      |||..|:: |..::::.|
Human   271 RNQGLYRLGNFLFILLGVCCIYSLFNVI------SILIKQVLNWMLRKLSCR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 29/88 (33%)
KCNK12NP_071338.1 ER retention/retrieval signal. /evidence=ECO:0000269|PubMed:24163367 11..16
Ion_trans_2 100..169 CDD:462301 4/27 (15%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 129..134
Ion_trans_2 222..304 CDD:462301 28/87 (32%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 256..261 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.