DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK13

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_071337.2 Gene:KCNK13 / 56659 HGNCID:6275 Length:408 Species:Homo sapiens


Alignment Length:131 Identity:36/131 - (27%)
Similarity:58/131 - (44%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 EDEKADGRQVPISLVLLIL--ASYI--CVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPAR 866
            |.:...|.:..:..|:|||  ||.:  |..:.::...|.||..|..|||||..||||:||.|.::
Human   183 EVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQ 247

  Fly   867 SFNGPELQLY-----------ACCAYLLLGLVLVAMSFSILETQLMW-----------KCKRIAV 909
            :.:.....||           .||.|.|..::.:     :::..|.|           :|:|..:
Human   248 NAHYESQGLYRFANFVFILMGVCCIYSLFNVISI-----LIKQSLNWILRKMDSGCCPQCQRGLL 307

  Fly   910 R 910
            |
Human   308 R 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 28/88 (32%)
KCNK13NP_071337.2 Ion_trans_2 <93..150 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 110..115
Ion_trans_2 206..285 CDD:462301 23/83 (28%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 237..242 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.