DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk10b

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_005169840.1 Gene:kcnk10b / 565629 ZFINID:ZDB-GENE-050420-31 Length:575 Species:Danio rerio


Alignment Length:279 Identity:69/279 - (24%)
Similarity:109/279 - (39%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEQAIKAKQ-PQPSQL---DC-----SIDDETDATEFGGLGGVGGAGCGSEMGAKTTASLTAKPR 59
            |:.::.|.| |...:|   .|     ||...:.:...|...|..|:...|.|..||..:      
Zfish    41 VQASVSAMQNPMGCELKNGHCLLPRLSISSRSASVLTGMDSGADGSALHSVMKWKTVLA------ 99

  Fly    60 SSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAP-QDISKSAAIAKSREDCLRELWII 123
                               :.::|:.|.|.|||.|..||.| :.|.|.:               |
Zfish   100 -------------------VFVVVLSYLVCGGLAFQALEQPFESIQKDS---------------I 130

  Fly   124 TEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDS 188
            |:|.....::| ..:.|..|   |..|..|....|.|              .|.:|...|   :|
Zfish   131 TQKKAQFLQKN-PCVSHADL---EALIKHAVEAVSTG--------------VSPIGDASY---NS 174

  Fly   189 QSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTY 253
            ..|....|..::.|||||||:|::.|.|..||:..|.||:.|:||....|:.:|    |.|...:
Zfish   175 SQWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVG----DQLGTMF 235

  Fly   254 VRLCCQLQR--HQEHRRKS 270
            ::...::::  .|:|::.|
Zfish   236 MKSILRVEKVFRQKHKQIS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 22/55 (40%)
Ion_trans_2 822..896 CDD:285168
kcnk10bXP_005169840.1 Ion_trans_2 172..231 CDD:285168 25/65 (38%)
Ion_trans_2 271..350 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.