DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcns3a

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001122196.1 Gene:kcns3a / 565375 ZFINID:ZDB-GENE-080723-45 Length:499 Species:Danio rerio


Alignment Length:141 Identity:33/141 - (23%)
Similarity:56/141 - (39%) Gaps:50/141 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 EAEDSEEEDEKAD-GRQVPI-------------------------------SLVLLILASYICVG 831
            |..|.||.:|..: ||.|.|                               .:.||||  ::.||
Zfish   281 EKVDPEESEELENVGRVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLIL--FLSVG 343

  Fly   832 TVIFALW-----------ENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLYACCAYLLLG 885
            ..||::.           |..::..|.::..::::|:||||..|...   |...:...|  ::.|
Zfish   344 ISIFSVLIYFVEREDHESELQTIPVGWWWATISMTTVGYGDTYPVTL---PGKLIGTLC--IICG 403

  Fly   886 LVLVAMSFSIL 896
            |::||:..||:
Zfish   404 LLVVALPISII 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 22/84 (26%)
kcns3aNP_001122196.1 BTB_POZ 15..122 CDD:453885
Ion_trans 189..426 CDD:459842 33/141 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.