DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcng2

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_690900.2 Gene:kcng2 / 562421 ZFINID:ZDB-GENE-100701-1 Length:546 Species:Danio rerio


Alignment Length:93 Identity:24/93 - (25%)
Similarity:44/93 - (47%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRH 263
            ::|..:||:|:|.:.||:..|::..:...|.|:.||...::|:..        |:.|...:|:..
Zfish   427 WAVISMTTVGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFH--------TFSRSYLELKEE 483

  Fly   264 QEHRRKSTPGTSTPSASSAANSREKDTD 291
            |....:..| .|..|..|..:...:|||
Zfish   484 QNRATRHKP-DSQDSTKSQNSEDSQDTD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 13/47 (28%)
Ion_trans_2 822..896 CDD:462301
kcng2XP_690900.2 BTB_POZ_KCNG1_2 68..175 CDD:349728
Ion_trans 237..481 CDD:459842 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.