DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk18

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001177236.2 Gene:kcnk18 / 561821 ZFINID:ZDB-GENE-100405-2 Length:391 Species:Danio rerio


Alignment Length:334 Identity:77/334 - (23%)
Similarity:128/334 - (38%) Gaps:92/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLE--APQD--------ISKSAAIAKSREDCLREL 120
            |..|...||....|:|.::.|:|||.|:|..:|  .|::        :.|...|.::..|...:.
Zfish    13 CSTLFWRLFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHTDASEQK 77

  Fly   121 WIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDA 185
            .:|.:...:|.:                                                :.|:.
Zfish    78 HLINKAKYILDD------------------------------------------------YCYEK 94

  Fly   186 GDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQ 250
            .....|:|..:|.:..||.||:|:|.:.|.|:.||:|.:.||:||:||||:.:|.:|.|||..|.
Zfish    95 ERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLS 159

  Fly   251 CTYVRLCCQLQR---HQEHRRKSTPGTST-PSASSAANSREKDTDKRSK---------------- 295
            ..|.||....:|   ||..|.:|...||. |.|       :.|||...|                
Zfish   160 KAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQA-------QADTDGTYKFNQDVVVLETTNNQQV 217

  Fly   296 -RRMANCKGCQYDAANSETSLNDCL---EYGQKGKLPPDKKEGDACQLLRNLNPQQHFYQQQQQQ 356
             :..::.:...:...|::...:..:   .:..||.|   .|.....:|.|...|:...:....|:
Zfish   218 IQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTL---SKSCSCPELDRVPTPKDELFNDIGQE 279

  Fly   357 PQQPDVMLM 365
            .:|.||.|:
Zfish   280 MEQLDVPLL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 26/55 (47%)
Ion_trans_2 822..896 CDD:285168
kcnk18NP_001177236.2 Ion_trans_2 <99..154 CDD:285168 24/54 (44%)
Ion_trans_2 292..367 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.