DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk1b

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001277277.1 Gene:kcnk1b / 561206 ZFINID:ZDB-GENE-090312-78 Length:337 Species:Danio rerio


Alignment Length:83 Identity:34/83 - (40%)
Similarity:52/83 - (62%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 LVLLILASYICVGTVIF-ALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLY--ACCA 880
            |.::.::.:..:...|| ||.|||:.::..||||::|||||.||:||..:||....:||  ....
Zfish   187 LAVVAVSCFFLIPAAIFSALEENWNFLESFYFCFISLSTIGLGDYVPGEAFNQRFRELYKLGITV 251

  Fly   881 YLLLGLVLVAMSFSILET 898
            ||||||:.:.:   :|||
Zfish   252 YLLLGLIAMLV---VLET 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 30/76 (39%)
kcnk1bNP_001277277.1 Ion_trans_2 <100..157 CDD:462301
Ion_trans_2 192..267 CDD:462301 33/78 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.