DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk2a

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_021323122.1 Gene:kcnk2a / 559728 ZFINID:ZDB-GENE-061226-2 Length:426 Species:Danio rerio


Alignment Length:175 Identity:49/175 - (28%)
Similarity:78/175 - (44%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQL 143
            :.|||:.|.::|..:|..||.|             |:.|::..||.||::.|...  |.:...:|
Zfish    63 IFLLVVLYLIIGATVFKALEQP-------------EEGLQKYRIIQEKIDFLSMH--TCVNTSEL 112

  Fly   144 RRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIG 208
            ......:|.|.|.|...|                    |:.:.:|..|..|.:..::.|||||||
Zfish   113 EDLVKQVVLAIRAGVNPS--------------------GHPSNESSMWDLSSSFFFAGTVITTIG 157

  Fly   209 HGSLTPRTAAGKLATIFYALVGVPLMLMCLS----SLGALLADGL 249
            .|:::|.|..|::..|.|||:|:||....|:    .||.:...|:
Zfish   158 FGNVSPHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/59 (39%)
Ion_trans_2 822..896 CDD:285168
kcnk2aXP_021323122.1 Ion_trans_2 <140..194 CDD:311712 21/53 (40%)
Ion_trans_2 232..310 CDD:311712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.