DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnc3a

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_073797827.1 Gene:kcnc3a / 559096 ZFINID:ZDB-GENE-100901-1 Length:666 Species:Danio rerio


Alignment Length:97 Identity:24/97 - (24%)
Similarity:47/97 - (48%) Gaps:29/97 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 LILASYICVGTVIFA----------------------LWENWSLVDGAYFCFVTLSTIGYGDFVP 864
            |:|..::.:|.:|||                      .::|..:  |.::..||::|:||||..|
Zfish   364 LLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTAFKNIPI--GFWWAVVTMTTLGYGDMYP 426

  Fly   865 ARSFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
             .:::|  :.:.|.||  |.|::.:||...::
Zfish   427 -ETWSG--MLVGALCA--LAGVLTIAMPVPVI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 24/95 (25%)
kcnc3aXP_073797827.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.