DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnf1a

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001076280.1 Gene:kcnf1a / 557280 ZFINID:ZDB-GENE-041001-217 Length:494 Species:Danio rerio


Alignment Length:110 Identity:24/110 - (21%)
Similarity:45/110 - (40%) Gaps:20/110 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 ILASYICVGTVIF-ALWENW----------SLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLY 876
            :|..|:.||..:| ||....          |:....::..:|::|:||||..|..:.......:.
Zfish   329 LLLMYMSVGIFLFSALGYTMEQSHPETMFTSIPQSFWWAIITMTTVGYGDIYPKTTLGRCNAAVS 393

  Fly   877 ACCAYLLLGL---------VLVAMSFSILETQLMWKCKRIAVRLK 912
            ..|..:.:.|         |:|.....:|||....:.:.:|:|.:
Zfish   394 FLCGVIAIALPIHPIINNFVIVYSKQRVLETAAKHEIELMALRAR 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 19/92 (21%)
kcnf1aNP_001076280.1 BTB_POZ_Kv5_KCNF1 21..136 CDD:349690
Ion_trans 184..420 CDD:459842 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.