DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK10

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:235 Identity:58/235 - (24%)
Similarity:93/235 - (39%) Gaps:67/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AKQPQPS-QLDCSIDDETDATEFGGLGGVGGAGCGSEMGAKTTASLTAKPRSSLRRCCGHLLKLL 73
            |..|.|: :|..|    :.||....:.|....|..:.|..||..:                    
Human    39 APAPTPTPRLSIS----SRATVVARMEGTSQGGLQTVMKWKTVVA-------------------- 79

  Fly    74 FSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRE-LWIITEKLNVLYERNWTM 137
                 :.::|:.|.|.|||:|..||.|.:.|:...||..:.:.||: :.:..::|.       |:
Human    80 -----IFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELE-------TL 132

  Fly   138 LVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVT 202
            :.|            |....:||.|                 ..|..:.:|..|....|..::.|
Human   133 IQH------------ALDADNAGVS-----------------PIGNSSNNSSHWDLGSAFFFAGT 168

  Fly   203 VITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242
            ||||||:|::.|.|..||:..|.||:.|:||....|:.:|
Human   169 VITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 22/52 (42%)
Ion_trans_2 822..896 CDD:285168
KCNK10NP_612190.1 Ion_trans_2 153..211 CDD:285168 23/56 (41%)
Ion_trans_2 249..328 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9913
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.