DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK9

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001269463.1 Gene:KCNK9 / 51305 HGNCID:6283 Length:374 Species:Homo sapiens


Alignment Length:193 Identity:46/193 - (23%)
Similarity:81/193 - (41%) Gaps:57/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|::....|.::|..:|..||:..::.:        |:.|:     .|::.:..:.|   :..
Human     8 TLSLIVCTFTYLLVGAAVFDALESDHEMRE--------EEKLK-----AEEIRIKGKYN---ISS 56

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
            |..|:.| .::..:....||                            ..|.|:.:..:::||||
Human    57 EDYRQLE-LVILQSEPHRAG----------------------------VQWKFAGSFYFAITVIT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRL-------CCQLQ 261
            |||:|...|.|.|||...:|||::|:||.|:...|||..:.     |:||.       ||.::
Human    93 TIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMN-----TFVRYLLKRIKKCCGMR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 25/69 (36%)
Ion_trans_2 822..896 CDD:462301
KCNK9NP_001269463.1 Ion_trans_2 <73..132 CDD:462301 27/86 (31%)
Selectivity filter 1. /evidence=ECO:0000305|PubMed:26919430 93..98 3/4 (75%)
Ion_trans_2 <183..243 CDD:462301
Selectivity filter 2. /evidence=ECO:0000305|PubMed:26919430 199..204
X-gate. /evidence=ECO:0000269|PubMed:38630723 243..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.