DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk7

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_002728904.1 Gene:Kcnk7 / 499303 RGDID:1565025 Length:316 Species:Rattus norvegicus


Alignment Length:178 Identity:39/178 - (21%)
Similarity:68/178 - (38%) Gaps:52/178 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LLVIGYSVLGGLLFPLLEAPQDI-------SKSAAIAKSREDCLRELWIITEKLNVLYERNWTML 138
            ||.:|   ||.::...||.|..:       ::.||.......||..                   
  Rat    18 LLAMG---LGAVVLQALEGPPALHLQVQLQAELAAFQAEHRACLPP------------------- 60

  Fly   139 VHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTV 203
              |.|....|:::.|...|                 .|:||    :..::.:|....|||::.::
  Rat    61 --EALEELLGAVLTAQAHG-----------------VSSLG----NGSETSNWDLPSALLFTASI 102

  Fly   204 ITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQC 251
            :||.|:|.:.|.::.||...:.||.:|:|..|..:::|...|.....|
  Rat   103 LTTTGYGRMAPFSSGGKAFCVVYAALGLPASLALVAALRRCLLPVFSC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 18/55 (33%)
Ion_trans_2 822..896 CDD:285168
Kcnk7XP_002728904.1 Ion_trans_2 <88..144 CDD:400301 17/55 (31%)
Ion_trans_2 178..>225 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.