DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk1

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001011490.1 Gene:kcnk1 / 496985 XenbaseID:XB-GENE-5846322 Length:330 Species:Xenopus tropicalis


Alignment Length:101 Identity:36/101 - (35%)
Similarity:58/101 - (57%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 ILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLY--ACCAYLLLG 885
            ||..::....:..||.::|:.::..||||::|||||.||:|||...|....|||  ....||:||
 Frog   192 ILCFFLIPAAIFSALEDDWNFLESFYFCFISLSTIGLGDYVPAEGQNQRYRQLYKFGITCYLILG 256

  Fly   886 LVLVAMSFSILET----QLMWKCKRIAVRLKLARAD 917
            |:::.:   :|||    |.:.|.:::..|.|:...|
 Frog   257 LIVMLV---VLETFCELQGLKKFRKMFYRKKMKEGD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 28/74 (38%)
kcnk1NP_001011490.1 Ion_trans_2 <101..157 CDD:311712
Ion_trans_2 192..267 CDD:311712 30/77 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.