DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and CG10864

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster


Alignment Length:241 Identity:70/241 - (29%)
Similarity:119/241 - (49%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGLGGVGGAGCGSEMGAKTTASLTA-KPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFP 95
            ||..|:||       |..:.:|..: :||..::|||.:.:..:.:..|:..|::.|::.|...|.
  Fly    12 GGTVGMGG-------GPSSVSSTPSNQPRKRVKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFM 69

  Fly    96 LLEAPQDISKSAA-IAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSA 159
            .:|. |.:.::|. :.:.|::|.::||.|||:.|::..|.||...::.||.::..|....:.|..
  Fly    70 HIER-QFVDETAGHVMELRQNCSQQLWSITEQHNIIDRRRWTEATNDVLREYQSQIAGVVKHGYV 133

  Fly   160 GSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATI 224
            |.|                        ..|.|||..||::.::|||.||:|::.|||..||..|:
  Fly   134 GRS------------------------PEQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTV 174

  Fly   225 FYALVGVPLMLMCLSSLGALLADGLQCTYVRL--CCQLQRHQEHRR 268
            .||..|:||.::...::|.:||...:..|..|  |.     |||.|
  Fly   175 IYATFGIPLYILYFLNMGRVLARSFKFLYRSLHDCT-----QEHPR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
CG10864NP_650726.1 Ion_trans_2 124..197 CDD:285168 29/96 (30%)
Ion_trans_2 242..>284 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.