DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Task6

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:69/167 - (41%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|::....|.::|..:|..||:..:..:..|:..:.:..:|:..|..|...|:          
  Fly     8 TISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVM---------- 62

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
                   .::|..:....||                            |.|.|:.|..|:.||:|
  Fly    63 -------ETVVLKSESHKAG----------------------------QQWKFTGAFYYATTVLT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242
            |||:|..||.|..|||.|:.||:||:||.|:...|:|
  Fly    93 TIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 28/66 (42%)
Ion_trans_2 822..896 CDD:462301
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 27/52 (52%)
Ion_trans_2 165..243 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.