DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Task7

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:218 Identity:52/218 - (23%)
Similarity:80/218 - (36%) Gaps:87/218 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 HGTPSRVP---------LIASPLSVP--QDSGENTTRNTAFNRHTLQPLSRKTLLLTRRCHRHAS 756
            |.||..:|         ::..||.:.  |..||.              |::...::.||..| ||
  Fly    99 HSTPVTIPGKAFCMGYAMVGIPLGLVMFQSIGER--------------LNKFASVIIRRAKR-AS 148

  Fly   757 GTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCDGKDCREAEDSEEEDEKADGRQVPISLVL 821
            |.                                .|                 .|..::.:.|..
  Fly   149 GA--------------------------------RC-----------------TDATEMNLMLAT 164

  Fly   822 LILAS-YICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARS----FNGP---ELQLYAC 878
            .:|:| .|..|..:|:.:|.||..|..|:|||||:|||:||:|..::    .|.|   .|.|   
  Fly   165 GMLSSIIITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSL--- 226

  Fly   879 CAYLLLGLVLVAMSFSILETQLM 901
             .::|.||.:||.|.::|..:.|
  Fly   227 -VFILFGLAVVAASINLLVLRFM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 31/81 (38%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168 9/47 (19%)
Ion_trans_2 166..248 CDD:285168 32/85 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
54.940

Return to query results.
Submit another query.